PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00148.1.g00250.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 425aa    MW: 45931.6 Da    PI: 6.8455
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00148.1.g00250.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.13.6e-17128175148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   rg W++eEde+l+  ++++G g+W+++++  g+ R++k+c++rw +yl
  Zmw_sc00148.1.g00250.1.am.mk 128 RGLWSPEEDEKLISHIAKYGHGCWSSVPKLAGLERCGKSCRLRWINYL 175
                                   788*******************************************97 PP

2Myb_DNA-binding55.71.1e-17181225147
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   rg +++eE++l+++++ +lG++ W+ Ia++++ gRt++++k++w++y
  Zmw_sc00148.1.g00250.1.am.mk 181 RGTFSQEEEDLIIQLHSMLGNK-WSQIAAHLP-GRTDNEVKNFWNSY 225
                                   899*******************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.7E-27120178IPR009057Homeodomain-like
PROSITE profilePS5129419.36123175IPR017930Myb domain
SuperFamilySSF466893.48E-30126222IPR009057Homeodomain-like
SMARTSM007173.8E-14127177IPR001005SANT/Myb domain
PfamPF002498.4E-16128175IPR001005SANT/Myb domain
CDDcd001671.40E-12131175No hitNo description
PROSITE profilePS5129427.254176230IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-26179230IPR009057Homeodomain-like
SMARTSM007173.1E-17180228IPR001005SANT/Myb domain
PfamPF002491.1E-16181225IPR001005SANT/Myb domain
CDDcd001672.88E-12183226No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MAPVPVFLSG PGPFLSFPLG HVINQAKEKR QETSSAAKRG ARTRAVACAT GKGKAGNENT  60
YLRSTSLLAS SSLHWHQSLL CSSSPSPSFP ACHHQNLGSS SRSAWTADTS DVDDGDTHSC  120
CHKKKLRRGL WSPEEDEKLI SHIAKYGHGC WSSVPKLAGL ERCGKSCRLR WINYLRPDLK  180
RGTFSQEEED LIIQLHSMLG NKWSQIAAHL PGRTDNEVKN FWNSYIKKRL RERGIDPATH  240
KPIADVSASD AATTGACHAV FCDAELIPTT AALLQAPLAE PMLDDVVKPP SDWTTAGSAA  300
PSSLSSYLQA GCSFDMDVLA LQQEQQRCHA IVAPAMPSAS CSSMLTMADS ENCNGIIAGA  360
GANLPWLELG PNTWHLDELR WSEYFDGAFQ AAPSQQGALQ GQCVYASGND DVAAIHVDVH  420
GLSNW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-2912523024128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002465218.11e-127hypothetical protein SORBIDRAFT_01g034270
TrEMBLA0A0A9ASW41e-151A0A0A9ASW4_ARUDO; Uncharacterized protein
STRINGSb01g034270.11e-127(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30923385